JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

TGF-beta 3, Human

SKU : BHP18500524

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

iXCells Biotechnologies

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	IX03430, IX03430-1, IX03430-10, IX03430-50
Reconstitution	Reconstituted in ddH?O at 100 ug/ml.
Description	Transforming growth factor beta 3(TGFB3) is a member of a TGF -beta superfamily which is defined by their structural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3 becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset of integrins. It binds with high affinity to TGF- beta RII, a type II serine/threonine kinase receptor. TGFB3 is involved in cell differentiation, embryogenesis and development. It is believed to regulate molecules involved in cellular adhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-beta3, mammals develop a deformity known as a cleft palate. Recombinant human TGF-beta3 produced by a mammalian expression system is a polypeptide chain containing 112 amino acids. A fully biologically active molecule; rh TGF-beta3 a molecular mass of 12.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
Formulation	Lyophilized from a 0.2 um filtered solution in 4mM HCl.
Molecular Weight	12.7 kDa; observed by reducing SDS-PAGE.
Source	Human Cells
Endotoxin Level	1 EU/ug; determined by LAL method.
Bioactivity	ED50 0.2 ng/ml, measured in a cell proliferation assay using mouse HT-2 cells.

Synonyms	Transforming growth factor beta-3,TGFB3, TGF-beta-3,Latency-associated peptide,LAP
Sequence	Ala³?¹-Ser?¹² (Accession #:P10600); ?ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVH?EPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTL?NPEASASPCCVPQDLEPLTILYYVGRTPKVEQLS?NMVVKSCKCS

Purity	95% as analyzed by SDS-PAGE.
Storage	Lyophilized recombinant TGF-beta3, human remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Human TGF-beta3 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP18500524-1	IX03430-1	1mg	$3744		Add to Cart
BHP18500524-2	IX03430-10	10ug	$245		Add to Cart
BHP18500524-3	IX03430-50	50ug	$687		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.