JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

TGF-beta 2, Human

SKU : BHP18500523

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

iXCells Biotechnologies

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	IX03429, IX03429-1, IX03429-10, IX03429-50
Description	Transforming growth factor beta-2 (TGF-beta2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD). Recombinant human TGF-beta2 produced by a mammalian expression system is a polypeptide chain containing 112 amino acids. A fully biologically active molecule; rh TGF-beta2 a molecular mass of 12.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
Reconstitution	Reconstituted in ddH?O at 100 ug/ml.
Formulation	Lyophilized from a 0.2 um filtered solution of 4 mM HCl.
Molecular Weight	12.7 kDa; observed by reducing SDS-PAGE.
Source	Human Cells
Endotoxin Level	1 EU/ug; determined by LAL method.
Bioactivity	ED50 0.2 ng/ml, measured in a cell proliferation assay using mouse HT-2 cells.

Synonyms	Transforming growth factor beta-2, TGFB2, Polyergin, G-TSF,Glioblastoma-derived T-cell suppressor factor,Cetermin,BSC-1 cell growth inhibitor,TGF-beta-2
Sequence	Ala³?³-Ser?¹? (Accession #:P61812); ?ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH?EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTI?NPEASASPCCVSQDLEPLTILYYIGKTPKIEQLS?NMIVKSCKCS

Purity	95% as analyzed by SDS-PAGE.
Storage	Lyophilized recombinant TGF-beta2, human remains stable up to 6 months at lower than -70°C from date of receipt. Upon reconstitution; Human TGF-beta2 should be stable up to 1 week at 4°C or up to 3 months at -20°C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP18500523-1	IX03429-1	1mg	$3744		Add to Cart
BHP18500523-2	IX03429-10	10ug	$245		Add to Cart
BHP18500523-3	IX03429-50	50ug	$687		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.