JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Yeast Recombinant AHA1 Protein

SKU : BHP11900118

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

StressMarq Biosciences Inc.

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPR-314, SPR-314A, SPR-314B, SPR-314C
Description	Yeast Recombinant AHA1 Protein
Alternative Names	Aha1 Protein, SHSA1 Protein, HSPC322 Protein, p38 Protein
Cellular Localization	Cytoplasm
Certificate Of Analysis	This product has been certified >90% pure using SDS - PAGE analysis.
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Regulatory	RUO
Scientific Background	Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).
Species	Yeast
Specificity	~405 kDa
Accession Number	NM_001180522.1
Concentration	Lot/batch specific. See included datasheet.
Purification	Affinity Purified
Expression System	E. coli
Amino Acid Sequence	MGHHHHHHMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDSASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL
Cite This Product	Yeast Recombinant AHA1 Protein (StressMarq Biosciences, Canada, Cat # SPR-314A)
Mol Weight	~405 kDa
Nature	Recombinant

Gross Weight (kg)	1.4
Launch Date	2011/08/01
Net Weight (g)	0.05
Swissprot	Q12449
Target Details	AHA1
Gene Id	851800
Research Area	Cancer, Heat Shock, Cell Signaling, Chaperone Proteins, Protein Trafficking
Target	AHA1

Adr Code	Non-hazardous
Country Of Origin	Canada
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Shipping	Blue Ice or 4ºC
Stock Product	Y
Tarriff Code	3822.19.0030
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Blue Ice or 4°C
Buffer	12.5mM Hepes buffer pH7.2, 10mM NaCl, 50% glycerol
Description	Accession Number: NM_001180522.1 Specificity: ~405 kDa Certificate of Analysis: This product has been certified >90% pure using SDS - PAGE analysis. Country of Origin: Canada Gross Weight (kg): 1.4 Net Weight (g): 0.05 Stock Product: Y
Purity	>90%
Storage Buffer	12.5mM Hepes buffer pH7.2, 10mM NaCl, 50% glycerol
Storage Temperature	-20°C

Immunogen Species	Saccharomyces Cerivisiae (Yeast)
Applications	Functional assay, WB, SDS-PAGE

Reference	1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub. 2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796. 3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723. 4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.

Product Manual	Datasheet
SDS

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP11900118-1	SPR-314A	50 ug	$226		Add to Cart
BHP11900118-2	SPR-314B	100 ug	$358		Add to Cart
BHP11900118-3	SPR-314C	100 ug x2	$572		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.