JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

WDR9/BRWD1 (BD2), His-tag

SKU : BHP18200088

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

BPS Bioscience

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	31115
Description	Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, GenBank Accession No. NM_018963, a.a. 1308 - 1436 corresponding to bromodomain 2 with N-terminal His-tag, MW = 16.2 kDa, expressed in an E. coli expression system. host species: E. coli Host species: E. coli
Immunogen Region	1308-1436
Tag	N-terminal His-tag
Formulation	40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol
Species	Human
Application	Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Notes	Avoid freeze/thaw cycles.
Amino Acid Sequence	MHHHHHHIRATNYVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEKLRRSQ
GenBank	NM_018963
Mw(kda)	16.2 kDa

Synonyms	bromodomain and WD repeat domain containing 1, BRWD1, WDR9, WD Repeat-Containing Protein 9
Uniprot	Q9NSI6

Shipping Temperature	-80°C (dry ice)
Format	Aqueous buffer solution
Storage	At least 6 months at -80°C.

Reference	1. Ramos, VC., et al., Biochim Biophys Acta. 2002 Sep 27;1577(3): 377-83 2. Huang, H., et al., Dev Dyn. 2003 Aug; 227(4): 608-14

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP18200088	31115	100 ug	$335.50		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.