JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

SMARCA2, His-tag

SKU : BHP18200084

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

BPS Bioscience

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	31111
Description	Human Bromodomain SMARCA2, also known as BRM, GenBank Accession No. NM_003070, a.a. 1375 - 1511 corresponding to single bromodomain with N-terminal His-tag, MW = 16.9 kDa, expressed in an E. coli expression system.
Immunogen Region	1375-1511
Tag	N-terminal His-tag
Formulation	40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol
Species	Human
Application	Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Notes	Avoid freeze/thaw cycles.
Amino Acid Sequence	MHHHHHHKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE
GenBank	NM_003070
Mw(kda)	16.9 kDa

Synonyms	SMARCA2, BRM, BRG1-Associated Factor 190B, SWI/SNF Related, Matrix Associated, Actin Dependent Regulator Of Chromatin 2, BAF190, SNF2L2
Uniprot	P51531

Shipping Temperature	-80°C (dry ice)
Format	Aqueous buffer solution
Storage	At least 6 months at -80°C.

Reference	1. Shain, A.H., et al., Proc Natl Acad Sci USA. 2012 Jan 31; 109(5): E252-9. 2. Liu, G., et al., Oncogene. 2011 Jul 21; 30(29): 3295-304

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP18200084	31111	100 ug	$335.50		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.