JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Recombinant Mucin 5 Subtype AC (MUC5AC)

SKU : BHP10102893

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

CLOUD-CLONE CORP.(CCC)

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RPA756Ra02
Alternative Names	TBM; MUC5; LeB; Oligomeric Mucus/Gel-Forming; Mucin 5,Subtypes A And C,Tracheobronchial/Gastric; Gastric mucin; Lewis B blood group antigen; Major airway glycoprotein, TBM ; MUC5 ; LeB ; Oligomeric Mucus/Gel-Forming ; Mucin 5,Subtypes A And C,Tracheobronchial/Gastric ; Gastric mucin ; Lewis B blood group antigen ; Major airway glycoprotein
Traits	Freeze-dried powder
Tag	Two N-terminal-Tags, His-Tag and T7-Tag
Source	Prokaryotic expression
Host	E.Coli(E.c)
Endotoxin Level	<1.0EU per 1ug (determined by the LAL method)
Expression System	Prokaryotic expression
Bioactivity	inactive
Buffer Formulation	PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Item Name	Mucin 5 Subtype AC
Nature	Recombinant
Predicted Molecular Mass(kd)	17.4kDa
Protein Length	Val324~Gln406+VGTPLRVEGFWQAWSGIGTLILNFLLLPVSRSSSTTRS

Sequence Info	Val324~Gln406+VGTPLRVEGFWQAWSGIGTLILNFLLLPVSRSSSTTRS
Research Area	Tumor immunity;Infection immunity;Endocrinology;Pulmonology;
Weight	17.4kDa

Purity	≥ 98%

Immunogen Species	Rattus norvegicus (Rat)
Organism Species	Rattus Norvegicus (Rat)
Applications	PC, SDS, WB, Positive Control, Immunogen, SDS-PAGE

Manual

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP10102893	RPA756Ra02	10ug	$170		Add to Cart
BHP10102893	RPA756Ra02	50ug	$425		Add to Cart
BHP10102893	RPA756Ra02	100ug	$680		Add to Cart
BHP10102893	RPA756Ra02	200ug	$850		Add to Cart
BHP10102893	RPA756Ra02	500ug	$1700		Add to Cart
BHP10102893	RPA756Ra02	1mg	$2550		Add to Cart
BHP10102893	RPA756Ra02	5mg	$6375		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.