JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Rat Natural HO-1 Full Length Protein

SKU : BHP11900130

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

StressMarq Biosciences Inc.

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPR-318, SPR-318A, SPR-318B, SPR-318C
Alternative Names	Heme oxygenase 1 Protein, HSP32 Protein, Hemox Protein, 32 kD Protein, bK286B10 Protein, D8Wsu38e Protein, heat shock protein 32kD Protein, Heat shock Protein, Heme oxygenase (decycling) 1 Protein, HMOX 1 Protein, Hmox Protein, HMOX1 Protein, HO 1 Protein, HO Protein, HO1 Protein
Cellular Localization	Endoplasmic Reticulum, Microsome
Certificate Of Analysis	This product has been certified >90% pure using SDS - PAGE analysis.
Description	Rat Natural HO-1 Full Length Protein
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Regulatory	RUO
Scientific Background	Heme-oxygenase is a ubiquitous enzyme that catalyzes the initial and rate-limiting steps in heme catabolism yielding equimolar amounts of biliverdin, iron and carbon monoxide. Biliverdin is subsequently converted to bilirubin and the free iron is sequestered to ferritin (1). These products have important physiological effects as carbon monoxide is a potent vasodilator; biliverdin and bilirubin are potent antioxidants; and the free iron increases oxidative stress and regulates the expression of many mRNAs (2). There are three isoforms of heme-oxygenase, HO-1, HO-2 and HO-3; however HO-1 and HO-2 are the major isoforms as they both have been identified in mammals (3). HO-1, also known as heat shock protein 32, is an inducible isoform activated by most oxidative stress inducers, cytokines, inflammatory agents and heat shock. HO-2 is a constitutive isoform which is expressed under homeostatic conditions. HO-1 is also considered to be a cytoprotective factor in that free heme is highly reactive and cytotoxic, and secondly, carbon monoxide is a mediator inhibiting the inflammatory process and bilirubin is a scavenger for reactive oxygen, both of which are the end products of heme catalyzation (4). It has also been shown that HO-1 deficiency may cause reduced stress defense, a pro-inflammatory tendency (5), susceptibility to atherosclerotic lesion formation (6), endothelial cell injury, and growth retardation (7). Up-regulation of HO-1 is therefore said to be one of the major defense mechanisms of oxidative stress (4).
Species	Rat
Specificity	~33 kDa
Accession Number	NP_036712.1
Concentration	Lot/batch specific. See included datasheet.
Purification	Ion-exchange Purified
Expression System	Native
Amino Acid Sequence	MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
Cite This Product	Rat Natural HO-1 Protein (StressMarq Biosciences, Canada, Cat # SPR-318A)
Mol Weight	~33 kDa
Nature	Natural
Protein Length	Full Length

Gross Weight (kg)	1.4
Launch Date	2015/01/05
Net Weight (g)	0.05
Swissprot	P06762
Target Details	HO-1
Gene Id	24451
Research Area	Cancer, Oxidative Stress
Target	HO-1

Adr Code	Non-hazardous
Country Of Origin	Canada
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Shipping	Blue Ice or 4ºC
Stock Product	Y
Tarriff Code	3822.19.0030
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Blue Ice or 4°C
Buffer	20mM Tris pH7.5, 0.1mM EDTA, 0.1% triton x-100, 0.2% Na cholate, <50mM KCl
Description	Accession Number: NP_036712.1 Specificity: ~33 kDa Certificate of Analysis: This product has been certified >90% pure using SDS - PAGE analysis. Country of Origin: Canada Gross Weight (kg): 1.4 Net Weight (g): 0.05 Stock Product: Y
Purity	>90%
Storage Buffer	20mM Tris pH7.5, 0.1mM EDTA, 0.1% triton x-100, 0.2% Na cholate, <50mM KCl
Storage Temperature	-80°C

Immunogen Species	Rattus Norvegicus (Rat)
Applications	WB, SDS-PAGE

Reference	1. Froh M. et al. (2007) World J. Gastroentereol 13(25): 3478-86. 2. Elbirt K.K. and Bonkovsky H.L. (1999) Proc Assoc Am Physicians 111(5): 348-47. 3. Maines M.D., Trakshel G.M., and Kutty R.K. (1986) J Biol Chem 261: 411419. 4. Brydun A., et al. (2007) Hypertens Res 30(4): 341-8. 5. Poss K.D. and Tonegawa S. (1997). Proc Natl Acad Sci U S A. 94: 1092510930. 6. Yet S.F., et al. (2003) FASEB J. 17: 17591761. 7. Yachie A., et al. (1999) J Clin Invest. 103: 129135.

Product Manual	Datasheet
SDS

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP11900130-1	SPR-318A	50 ug	$505		Add to Cart
BHP11900130-2	SPR-318B	100 ug	$780		Add to Cart
BHP11900130-3	SPR-318C	100 ug x2	$1368		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.