JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

IL-2, Human

SKU : BHP18500004

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

iXCells Biotechnologies

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	IX00368, IX00368-1, IX00368-10, IX00368-50
Description	In vitro studies performed on human cell lines demonstrate the immunoregulatory properties of Interleukin-2 (IL-2) including: 1) enhancement of lymphocyte mitogenesis and stimulation of long-term growth of human Interleukin-2 (IL-2) dependent edll lines; 2) enhancement of lymphocyte cytotoxicity; 3) induction of killer cell (lymphokine-activated (LAK) and natural (NK)) activity; 4) induction of interferon-gamma production. Recombinant human Interleukin-2 (IL-2) is a highly purified protein with a molecular weight of approximately 15,300 Da. The chemical name is des-alanyl-1, serine-125 human interleukin-2. It is produced by recombinant DNA technology using a genetically engineered E. coli strain containing an analog of the human Human Interleukin-2 (IL-2) gene.
Reconstitution	It is recommended to reconstitute the lyophilized recombinant human Interleukin-2 (IL-2) in sterile 18 Momega-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Formulation	The protein was lyophilized after extensive dialysis against 50mM Phosphate buffer, pH7.5, 5% Mannitol buffer.
Molecular Weight	15,300 Da
Source	E. coli
Host	Human
Endotoxin Level	Less than 0.1 ng/ug (1 EU/ug) of recombinant human Interleukin-2 (IL-2) as determined by LAL test.
Notes	For research use only
Bioactivity	The ED50 as determined by the dose-dependant stimulation of the proliferation of CTLL-2 was found to be 0.1 ng/ml, corresponding to a specific activity of 1x107 IU/mg.

Synonyms	rHuIL-2; rHuIL2; Interleukin-2; Interleukin2
Sequence	Ala²¹-Thr¹?³ (Accession #: P60568), With a N-terminal Met?MAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTR?MLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKN?FHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVE?FLNRWITFCQSIISTLT

Purity	Greater than 95% as determined by the following methods:(a) SEC-HPLC analysis(b) Reducing and non-reducing SDS-PAGE silver-stained gel analysis
Storage	Lyophilized recombinant human Interleukin-2 (IL-2) remains stable at room temperature for three weeks, but it is best stored desiccated below -18°C. Upon reconstitution recombinant human Interleukin-2 (IL-2) should be stored at 4°C for up to seven days. For long term storage it is recommended that a carrier protein (0.1% HSA or BSA) be added. Avoid repeated freeze-thaw cycles.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP18500004-1	IX00368-1	1mg	$799		Add to Cart
BHP18500004-2	IX00368-10	10ug	$82		Add to Cart
BHP18500004-3	IX00368-50	50ug	$199		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.