JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Human Recombinant Tau-352 (fetal 0N3R) Wild-Type Monomers

SKU : BHP11901219

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

StressMarq Biosciences Inc.

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPR-490, SPR-490B, SPR-490C, SPR-490XE, SPR-490E, SPR-490XG
Alternative Names	Tau aggregate, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, 95-amino acid Tau protein fragment, Truncated Tau
Cellular Localization	Cell membrane, Cytoskeleton, Growth cone, Peripheral membrane protein, Tubulin complex, Axolemma, Axolemma Plasma Membrane, Axon, Cell Body, Cytoplasm, Cytoplasmic Ribonucleoprotein Granule, Cytoplasmic Side, Cytosol, Dendrite, Microtubule, Microtubule Associated Complex, Neurofibrillary Tangle, Neuronal Cell Body, Nuclear Periphery, Nuclear Speck, Nucleus, Plasma Membrane
Certificate Of Analysis	Protein certified >95% pure on SDS-PAGE & Nanodrop analysis
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Scientific Background	Alzheimer s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing paired helical filaments (PHFs). Brain-specific tau isoforms vary in the number of N-terminal inserts and C- terminal repeat domains due to alternative splicing of exons; only the shortest isoform of tau, 0N3R, is expressed in the fetal brain during neurogenesis (2). Three-repeat (3R) isoforms have been shown to be more prone than four-repeat (4R) isoforms to form oligomers in vitro (3). The beta-sheet core of Tau 0N3R fibrilized using heparin differs from all other tau fibril structures known to date (4).
Species	Human
Specificity	37 kDa
Accession Number	NP_058525.1
Concentration	Lot/batch specific. See included datasheet.
Purification	Ion-exchange Purified
Expression System	E. coli
Amino Acid Sequence	MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Biological Activity Abreviation	Active
Cite This Product	Human Recombinant Tau352 (fetal 0N3R) Monomers (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-490)
Nature	Recombinant
Protein Length	Full Length (1-352 aa)

Gross Weight (kg)	1.4
Launch Date	2023/02/03
Net Weight (g)	0.01
Swissprot	P10636-2
Target Details	Tau-352 (fetal 0N3R)
Gene Id	4137
Research Area	Tangles & Tau, Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Cytoskeleton

Adr Code	Non-hazardous
Country Of Origin	Canada
Tarriff Code	3822.19.0030
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Purity	>95%
Storage Buffer	10 mM Hepes pH 7.4, 100 mM NaCl
Storage Temperature	-80°C

Applications	In vitro assay, WB, SDS-PAGE

Reference	1. www.alz.org/alzheimers-dementia/facts-figures 2. Goedert et al. Multiple isoforms of human microtubule-associated protein tau: Sequences and localization in neurofibrilary tangles of Alzheimer s disease. Neuron. 1989;3(4):519-526. 3. Shahpasand-Kroner et al. Three-repeat and four-repeat tau isoforms for different oligomers. Prot. Sci. 2021;doi: 10.1002/pro4257 4. Dregni, et al. Inclusion of the C?Terminal Domain in the beta?Sheet Core of Heparin-Fibrillized Three-Repeat Tau Protein Revealed by Solid-State Nuclear Magnetic Resonance Spectroscopy. JACS. 2021. https://doi.org/10.1021/jacs.1c03314

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP11901219-1	SPR-490B	100 ug	$382		Add to Cart
BHP11901219-2	SPR-490C	100 ug x2	$611		Add to Cart
BHP11901219-3	SPR-490XE	500 ug (5 mg/ml)	$1178		Add to Cart
BHP11901219-4	SPR-490E	100 ug x5	$1240		Add to Cart
BHP11901219-5	SPR-490XG	500 ug x2 (5 mg/ml)	$2121		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.