JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Human Recombinant Rab5 Protein

SKU : BHP11900040

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

StressMarq Biosciences Inc.

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPR-121, SPR-121A, SPR-121B, SPR-121C
Description	Human Recombinant Rab5 Protein
Alternative Names	Rab 5A Protein, RAS associated protein RAB5A Protein, Ras related protein Rab 5 A Protein
Cellular Localization	Cell Membrane, Early Endosome Membrane, Melanosome
Certificate Of Analysis	This product has been certified >90% pure using SDS-PAGE analysis.
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Regulatory	RUO
Scientific Background	Rab5 is a 24kDa member of the Rab family of small guanosine triphosphatases (GTPases), Ras superfamily. Rab GTPases are central regulators of membrane trafficking in the eukaryotic cell. Their regulatory capacity depends on their ability to cycle between the GDP -bound inactive and GTP-bound active states. This conversion is regulated by GDP/GTP exchange factors (GEPs), GDP dissociation inhibitors (GDIs) and GTPase-activating proteins (GAPs) (1, 2). Activation of a Rab protein is coupled to its association with intracellular membranes, allowing it to recruit downstream effector proteins to the cytoplasmic surface of a subcellular compartment (3). Through these proteins, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion(1). Rab proteins contain conserved regions involved in guanine-nucleotide binding, and hyper variable COHO-terminal domains with a cysteine motif implicated in subcellular targeting. Post-translational modification of the cysteine motif with one or two geranyl groups is essential for the membrane association and correct intracellular localization of Rab proteins(3). Each Rab shows a characteristic subcellular distribution (4). In particular, Rab5 is ubiquitously expressed in human tissues. It localizes mainly to early endosomes, but is also present on the plasma membrane. It regulates the fusion between endocytic vesicles and early endosomes, as well as the homotypic fusion between early endosomes (5). Among the proteins recruited by the GTP-bound active Rab5 are Rabaptin-5 and EEA1 (6). Anti-Rab5 may be used as an early endosome marker.
Species	Human
Specificity	~26 kDa
Accession Number	BC001267
Concentration	Lot/batch specific. See included datasheet.
Purification	Affinity Purified
Expression System	E. coli
Amino Acid Sequence	MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Cite This Product	Human Recombinant Rab5 Protein (StressMarq Biosciences, Canada, Cat # SPR-121A)
Mol Weight	~26 kDa
Nature	Recombinant

Gross Weight (kg)	1.4
Launch Date	2009/05/20
Net Weight (g)	0.05
Swissprot	P20339
Target Details	Rab5
Gene Id	5868
Research Area	Cancer, Heat Shock
Target	Rab5

Adr Code	Non-hazardous
Country Of Origin	Canada
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Shipping	Blue Ice or 4ºC
Stock Product	Y
Tarriff Code	3822.19.0030
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Blue Ice or 4°C
Buffer	20mM Tris/HCl pH7.5, 0.45M NaCl, 10% glycerol, 0.5mM DTT
Description	Accession Number: BC001267 Specificity: ~26 kDa Certificate of Analysis: This product has been certified >90% pure using SDS-PAGE analysis. Country of Origin: Canada Gross Weight (kg): 1.4 Net Weight (g): 0.05 Stock Product: Y
Purity	>90%
Storage Buffer	20mM Tris/HCl pH7.5, 0.45M NaCl, 10% glycerol, 0.5mM DTT
Storage Temperature	-20°C

Immunogen Species	Homo Sapiens (Human)
Applications	WB, SDS-PAGE

Reference	1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.

Product Manual	Datasheet
SDS

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP11900040-1	SPR-121A	50 ug	$468		Add to Cart
BHP11900040-2	SPR-121B	100 ug	$867		Add to Cart
BHP11900040-3	SPR-121C	100 ug x2	$1561		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.