JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils

SKU : BHP11901232

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

StressMarq Biosciences Inc.

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPR-504, SPR-504B, SPR-504C, SPR-504E
Alternative Names	Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein TNG
Certificate Of Analysis	Protein certified >95% pure on SDS-PAGE & Nanodrop analysis, low endotoxin
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Scientific Background	Human alpha synuclein TNG mutant (HuTNG) is a triple mutant containing Ala53 mutated to the equivalent mouse residue Thr53, Ser87 mutated to the equivalent mouse residue Asn87, and Asn103 mutated to the equivalent mouse residue Gly103, effectively making it a human-mouse chimeric protein. <br />Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse alpha-syn (MsWT) is faster than wild-type human alpha-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing endogenous mouse alpha-syn pathology (1). A53T or S87N substitutions in human alpha-syn substantially accelerate fibrilization rates in vitro (2,3).<br />Chimeric HuTNG fibrils show enhanced induction of alpha-syn pathology greater than both HuWT and MsWT fibrils after single unilateral injection into the dorsal striatum in mice (4). <br />Therefore, HuTNG is a good construct for inducing robust endogenous alpha-syn seeding and pathology in wild-type mice.
Species	Human
Specificity	14.46 kDa
Concentration	Lot/batch specific. See included datasheet.
Purification	Ion-exchange Purified
Expression System	E. coli
Amino Acid Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Cite This Product	Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils (StressMarq Biosciences Inc. \| Victoria BC CANADA \| Catalog # SPR-504B)
Nature	Recombinant
Protein Length	Full length (1 - 140 aa)

Gross Weight (kg)	1.4
Launch Date	2023/11/08
Net Weight (g)	0.01
Swissprot	P37840-1
Target Details	Alpha Synuclein TNG (A53T, S87N, N103G)
Research Area	Tangles & Tau, Multiple System Atrophy, Neurodegeneration, Alzheimer's Disease, Parkinson's Disease, Synuclein, Neuroscience

Adr Code	Non-hazardous
Country Of Origin	Canada
Tarriff Code	3822.00.1090
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Purity	>95%
Storage Buffer	1X PBS pH7.4
Storage Temperature	-80°C

Applications	In vivo assay, In vitro assay, WB

Reference	1. Masuda-Suzukake et al. 2013. Prion-like Spreading of Pathological alpha-synuclein in Brain. Brain. https://doi.org/10.1093/brain/awt037<br />2. Kang, K. et al. 2011. The A53T Mutation is Key in Defining the Differences in the Aggregation Kinetics of Human and Mouse alpha-synuclein. JACS. https://doi.org/10.1021/ja203979j<br />3. Ohgita, T. et al. 2023. Intramolecular Interaction Kinetically Regulates Fibril Formation by Human and Mouse Alpha-Synuclein. Sci Rep https://doi.org/10.1038/s41598-023-38070-4<br />4. Luk, K., C. et al. 2016. Molecular and Biological Compatibility with Host Alpha-Synuclein Influences Fibril Pathogenicity. Cell Rep. https://doi.org/10.1016/j.celrep.2016.08.054

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP11901232-1	SPR-504B	100 ug	$432		Add to Cart
BHP11901232-2	SPR-504C	2x100 ug	$691		Add to Cart
BHP11901232-3	SPR-504E	5x100 ug	$1405		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.