Alpha Synuclein Protein

Mfr.No.	SPR-322-A594, SPR-322B-A594, SPR-322C-A594, SPR-322E-A594
Description	Active Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)
Alternative Names	Alpha synuclein PFFs, Alpha synuclein aggregates, Alpha synuclein PFF, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha synuclein protein seed, ATTO 594 conjugated alpha synuclein, ATTO labelled alpha synuclein fibrils
Biological Activity	Under Investigation
Cellular Localization	Cytoplasm, Membrane, Nucleus
Certificate Of Analysis	Thioflavin T emission curve shows increased fluorescence (correlated to protein fibrillation) when active alpha Synuclein PFFs:ATTO-594 are combined with active alpha Synuclein monomers. Passed sterility test (OD600 equivalent to negative control (dH20) after 72 hr incubation at 37C, 200 rpm in rich medium)
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Scientific Background	Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
Species	Human
Specificity	N/A
Accession Number	NP_000336.1
Concentration	Lot/batch specific. See included datasheet.
Purification	Ion-exchange Purified
Expression System	E. coli
Amino Acid Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG
Bioactivity	Under Investigation
Biological Activity Abreviation	Active
Cite This Product	Human Recombinant Alpha Synuclein Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-322B-A594)
Mol Weight	N/A
Nature	Recombinant
Other Relevant Information	For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or on the product datasheet for further information.
Protein Length	Full Length

Gross Weight (kg)	1.4
Launch Date	2020/05/14
Net Weight (g)	0.01
Swissprot	P37840
Target Details	Alpha Synuclein: ATTO 594
Gene Id	6622
Research Area	Tangles & Tau, Multiple System Atrophy, Neurodegeneration, Alzheimer's Disease, Parkinson's Disease, Synuclein, Neuroscience
Target	Alpha Synuclein

Adr Code	Non-hazardous
Country Of Origin	Canada
Stock Product	Y
Tarriff Code	3822.19.0030
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Purity	>95%
Storage Buffer	PBS pH7.4, 0.09% Azide
Storage Temperature	-80°C

Applications	In vivo assay, In vitro assay, WB, SDS-PAGE

Reference	1. Genetics Home Reference: SNCA. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Combination SKU	Supplier No.	Size	Your price
BHP11901098-1	SPR-322B-A594	100 ug	$443	Add to Cart
BHP11901098-2	SPR-322C-A594	100 ug x2	$710	Add to Cart
BHP11901098-3	SPR-322E-A594	100 ug x5	$1441	Add to Cart

Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)

Contact us to order

Tel

Email

Contact us to order

Tel

Email

Reviews of Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)

Rate it now..!!