JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

HCV1b (R155Q), FLAG-His-tags

SKU : BHP18200792

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

BPS Bioscience

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	80104
Description	Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1b (GenBank Accession No. AF054247) with Arg-to-Gln mutation on a.a. 155, an N-terminal FLAG-His tag, and a 4 a.a. linker, MW = 22.3 kDa, expressed in an E. coli expression system.
Immunogen Region	21-32 of NS4A, linker (4 a.a.) and a.a. 3-181 of NS3
Tag	N-terminal FLAG-His-tags
Formulation	40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 335 mM imidazole, and 20% glycerol.
Species	Human
Application	Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling
Notes	Avoid freeze/thaw cycles.
Amino Acid Sequence	MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFQAAVCTRGVAKAVDFIPVESMETTMRS
GenBank	AF054247
Mw(kda)	22.3 kDa

Synonyms	hepatitis c virus genotype 1b Q155
Uniprot	O92972

Shipping Temperature	-80°C (dry ice)
Format	Aqueous buffer solution
Storage	At least 6 months at -80°C.

Reference	1. Lin, C., et al., Hepatitis C Viruse. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6. 2. Lang Kuhs, K.A., et al., Mol. Ther. 2012 May;20(3):669-678. 3. Massariol, MJ., et al., Biochem Biophys Res Commun. 2010 Jan 1;391(1):692-697.

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP18200792	80104	20 ug	$456.50		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.