JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

HCV1a, FLAG-His-tags

SKU : BHP18200781

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

BPS Bioscience

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	80010
Description	Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1a (HCV1a), GenBank Accession No. NC_004102, with N-terminal FLAG-His tag, MW = 22.4 kDa, expressed in an E. coli expression system.
Immunogen Region	21-32 of NS4A, linker (4 a.a.) and a.a. 3-181 of NS3
Tag	N-terminal FLAG-His-tags
Formulation	40 mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2 mM KCl, 0.04% Tween-20,20% glycerol, and 250 mM imidazole.
Species	Human
Application	Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling
Notes	Avoid freeze/thaw cycles.
Amino Acid Sequence	MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
GenBank	NC_004102
Mw(kda)	22.4 kDa

Synonyms	hepatitis c virus genotype 1a
Uniprot	P27958

Shipping Temperature	-80°C (dry ice)
Format	Aqueous buffer solution
Storage	At least 6 months at -80°C.

Reference	1. Lin, C., et al., Hepatitis C Virus. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6. 2. Prabhu, R., et al., Exp Mol Pathol. 2004 Jun;76(3):242-52.

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP18200781	80010	20 ug	$456.50		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.