JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

GCN5 (727-837), His-tag

SKU : BHP18200087

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

BPS Bioscience

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	31114
Description	Human GCN5 or KAT2A containing bromodomain, GenBank Accession No. NM_021078, a.a. 727 - 837 (end) corresponding to single bromodomain with N-terminal His-tag, MW = 14.1 kDa, expressed in an E. coli expression system.
Immunogen Region	727-837
Tag	N-terminal His-tag
Formulation	40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol
Species	Human
Application	Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Notes	Avoid freeze/thaw cycles.
Amino Acid Sequence	MHHHHHHLKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
GenBank	NM_021078
Mw(kda)	14.1 kDa

Uniprot	Q92830

Shipping Temperature	-80°C (dry ice)
Format	Aqueous buffer solution
Storage	At least 6 months at -80°C.

Reference	1. Li, S., et al., J Biol Chem. 2009 Apr 3; 284(14): 9411-7 2. Santillan, D.A., et al., Cancer Res. 2006 Oct 15; 66(20): 10032-9Application Reference:Quantitating the specificity and selectivity of Gcn5-mediated acetylation of histone H3 (2013)

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP18200087	31114	100 ug	$335.50		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.