JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide

BRPF1, His-tag

SKU : BHP18200085

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

BPS Bioscience

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	31112
Description	Human Bromodomain and PHD finger containing 1, also known as BRPF1, GenBank Accession No. NM_001003694, a.a. 627 - 746 corresponding to single bromodomain with N-terminal His-tag, MW = 15.1 kDa, expressed in an E. coli expression system. host species: E. coli Host species: E. coli
Immunogen Region	2054-2168
Tag	N-terminal His-tag
Formulation	40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol
Species	Human
Application	Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Notes	Avoid freeze/thaw cycles.
Amino Acid Sequence	MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG
GenBank	NM_013450
Mw(kda)	14.3 kDa

Synonyms	Human Bromodomain and PHD finger containing 1, BRPF1
Uniprot	P55201

Shipping Temperature	-80°C (dry ice)
Format	Aqueous buffer solution
Storage	At least 6 months at -80°C.

Reference	1. Laue, K., et al., Development. 2008 June; (135)111: 1935-46. 2. Mayya, V., et al., Sci Signal. 2009 Aug 18; 2(84): ra46

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHP18200085	31112	100 ug	$335.50		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.