JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.
Loding Loading ....
Home / Proteins & Peptide

Adenine Nucleotide Translocator 2 protein (STJ503646)

BHP15500170
Contact us to order
Tel
+1 866.986.9598
Email
[email protected]
Get a Quote
Request More Infos
Order Now

Credit card payments now incur a 3% fee.

Contact us to order
Tel
+1 866.986.9598
Email
[email protected]
Get a Quote
Ask Merchant
Request More Infos
Sample Request
Uniprot P05141
Storage Store at-20°C for long term storage. Avoid freeze-thaw cycles.
Immunogen Species 150-200
Immunological Activity Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2. NA NA NA NA Sequence: NA NA AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
Applications Immunodepletion, Immunocompetition
SKU Supplier No. Size Your price Quantity
BHP15500170 STJ503646 250 ug $361.77
Add to Cart