JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies

ULK1 Antibody (RQ6015)

SKU : BHA17110653

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ6015
Clonality	Polyclonal
Description	ULK1 is an enzyme that in humans is encoded by the ULK1 gene. It is mapped to 12q24.33. Unc-51 like autophagy activating kinase (ULK1/2) are two similar isoforms of an enzyme that in humans are encoded by the ULK1/2 genes. It is specifically a kinase that is involved with autophagy, particularly in response to amino acid withdrawal. Not many studies have been done comparing the two isoforms, but some differences have been recorded.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK from the human protein were used as the immunogen for the ULK1 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No
Subcellular Location	Cytoplasmic

Uniprot	O75385

Buffer	Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Format	Antigen affinity purified
Purification	Affinity purified
Storage	After reconstitution, the ULK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P, FACS
Dilution	Weste blot: 0.5-1ug/ml,Immunohistochemistry: 1-2ug/ml,Flow cytometry: 1-3ug/million cells

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17110653	RQ6015	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.