JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

STXBP2 Antibody / UNC18-2 (R32239)

SKU : BHA17105571

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32239
Clonality	Polyclonal
Description	Syntaxin-binding protein 2, also known as UNC18B and UNC18-2, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alteatively spliced transcript variants encoding different isoforms have been noted for this gene.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No

Uniprot	Q15833

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the STXBP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IF, FACS
Dilution	Weste blot: 0.1-0.5ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105571	R32239	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.