JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies

Sorcin Antibody / SRI (RQ4661)

SKU : BHA17109441

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ4661
Clonality	Polyclonal
Description	Sorcinis aproteinthat in humans is encoded by theSRIgene. It is mapped to 7q21.1. This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alteative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids TVDPQELQKALTTMGFRLSPQAVNSIAKRY were used as the immunogen for the SRI antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No
Subcellular Location	Cytoplasmic, nuclear

Uniprot	P30626

Format	Purified
Purification	Antigen affinity purified
Storage	After reconstitution, the SRI antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P
Dilution	Weste blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17109441	RQ4661	100ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.