JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies

PDPK1 Antibody / 3-phosphoinositide-dependent protein kinase 1 (R31813)

SKU : BHA17105174

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R31813
Clonality	Polyclonal
Description	3-phosphoinositide dependent protein kinase-1 is a protein which in humans is encoded by the PDPK1 gene. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ of human PDPK1 were used as the immunogen for the PDPK1 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No
Subcellular Location	Cytoplasmic

Uniprot	O15530

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the PDPK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P, IHC-F
Dilution	Weste blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunohistochemistry (Frozen): 0.5-1ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105174	R31813	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.