JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

NUR77 Antibody (R32021)

SKU : BHA17105367

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32021
Antigen	NUR77
Clonality	Polyclonal
Description	Nuclear receptor subfamily 4, group A, member 1, also called NAK1, GFRP1, TR3, NUR77 or NGFIB, is a protein that in humans is encoded by the NR4A1 gene, and a member of the Nur nuclear receptor family of intracellular transcription factors. NR4A1 is involved in cell cycle mediation, inflammation and apoptosis. It plays a key role in mediating inflammatory responses in macrophages. In addition, subcellular localization of the NR4A1 protein appears to play a key role in the survival and death of cells. Nr4a1 is overexpressed in Wnt1 -transformed mouse mammary cells. Nr4a1 is also induced by lithium, a Wnt1 mimic, and the Nr4a1 promoter is activated by lithium and beta-catenin, a Wnt1 downstream effector. In contrast, human NR4A1 is not upregulated by beta-catenin, indicating that this gene is regulated differently in human and mouse cells. Adenoviral expression of Nr4a1 induces genes involved in gluconeogenesis, stimulates glucose production both in vitro and in vivo, and raises blood glucose levels.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD of human NUR77 were used as the immunogen for the NUR77 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No

Uniprot	P22736

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the NUR77 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB
Dilution	Western blot: 0.1-0.5ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105367	R32021	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.