MMP9 Antibody - BHA17105317

Mfr.No.	R31968
Clonality	Polyclonal
Description	Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY of human MMP9 were used as the immunogen for the MMP9 antibody.
Isotype	IgG
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No
Subcellular Location	Nuclear, cytoplasmic

Uniprot	P14780

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the MMP9 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P, ELISA
Dilution	Weste blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,ELISA: 0.1-0.5ug/ml (human protein tested); request BSA-free format for coating