JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

MGA Antibody (R32278)

SKU : BHA17105608

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32278
Clonality	Polyclonal
Description	Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus, GAS) in response to changing environmental conditions. It had been found that the mouse transcription factor Max interacted with Mga. Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells. EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG. The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max. Mga repressed transcription of a reporter driven from a T-box-binding site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site. Expression of Mga with Max, but not Mga alone, activated transcription from a reporter containing the E-box site.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH of human MGA were used as the immunogen for the MGA antibody.
Isotype	IgG
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No

Uniprot	Q8IWI9

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the MGA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB
Dilution	Weste blot: 0.1-0.5ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105608	R32278	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.