JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

MAPK13 Antibody / SAPK4 (R31807)

SKU : BHA17105169

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R31807
Clonality	Polyclonal
Description	MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4 (SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No
Subcellular Location	Nuclear, cytoplasmic

Uniprot	O15264

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the SAPK4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P
Dilution	Weste blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105169	R31807	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.