JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies

Keratocan Antibody (R31830)

SKU : BHA17105187

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R31830
Clonality	Polyclonal
Description	Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in coeal transparency. Defects in this gene are a cause of autosomal recessive coea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the coea.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse
Reactivity	Human, Mouse
Recombinant	No

Uniprot	O60938

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the Keratocan antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB
Dilution	Weste blot: 0.1-0.5ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105187	R31830	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.