JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies

IL1 beta Antibody (R32818)

SKU : BHA17106112

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32818
Clonality	Polyclonal
Description	Interleukin-1 beta (IL-1b) is a potent stimulator of bone resorption whose gene is mapped to 2q14, and has been implicated in the pathogenesis of high bone tuover and osteoporosis. IL-1b, a prominent microglia-derived cytokine, caused oligodendrocyte death in coculture with astrocytes and microglia, but not in pure culture of oligodendrocytes alone. It also can cause nuclear export of a specific NCOR corepressor complex, resulting in derepression of a specific subset of nuclear factor-kappa-B (NFKB)-regulated genes. Furthermore, Microenvironmental IL-1b and, to a lesser extent, IL-1? are required for in vivo angiogenesis and invasiveness of different tumor cells. Additional, the cooperation of IL-1b and PDGFB induces contractile-to-synthetic phenotype modulation of human aortic smooth muscle cells in culture. Moreover, the association with disease may be explained by the biologic properties of IL-1b, which is an important proinflammatory cytokine and a powerful inhibitor of gastric acid secretion.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE were used as the immunogen for the IL1B antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse
Reactivity	Human, Mouse
Recombinant	No

Uniprot	P10749

Buffer	Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the IL1B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB
Dilution	Weste Blot: 0.5-1ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17106112	R32818	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.