JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies

IGFBP5 Antibody (R32028)

SKU : BHA17105374

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32028
Clonality	Polyclonal
Description	Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene. The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in two human breast cancer cell lines. IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis. Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice. It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells. Additionally, IGFBP-5 is expressed by fibroblasts, myoblasts and osteoblasts, making it the predominant IGFBP found in bone extracts. It has a strong affinity for hydroxyapatite, allowing it to bind to bone cells. When bound to extracellular matrix, IGFBP-5 is protected from proteolysis and potentiates IGF activity, but when it is soluble, IGFBP-5 is cleaved into inactive fragments.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER of human IGFBP5 were used as the immunogen for the IGFBP5 antibody.
Isotype	IgG
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No

Uniprot	P24593

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the IGFBP5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, ELISA
Dilution	Weste blot: 0.1-0.5ug/ml,ELISA : 0.1-0.5ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105374	R32028	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.