JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

EEF2 Antibody / Elongation factor 2 (RQ6253)

SKU : BHA17110890

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ6253
Clonality	Polyclonal
Description	Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the Elongation factor 2 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat, Monkey
Reactivity	Human, Mouse, Rat, Monkey
Recombinant	No
Subcellular Location	Cytoplasmic, nuclear

Uniprot	P13639

Format	Antigen affinity purified
Purification	Affinity purified
Storage	After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P, IF, FACS
Dilution	Weste blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17110890	RQ6253	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.