JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies

DHODH Antibody (RQ6735)

SKU : BHA17119148

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ6735
Cellular Localization	nuclear, Cytoplasmic
Clonality	Polyclonal (rabbit origin)
Description	Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
Host	Rabbit
Immunogen Region	N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D from the human protein were used as the immunogen for the Dihydroorotate dehydrogenase antibody.
Isotype	Rabbit IgG
Reactivity	Human, Mouse, Rat
Recombinant	No

Uniprot	Q02127

Buffer	Lyophilized from 1X PBS with 2% Trehalose
Concentration	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format	Antigen affinity purified
Purification	Antigen affinity purified
Storage	After reconstitution, the Dihydroorotate dehydrogenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Applications	WB, IHC-P
Dilution	Weste blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17119148	RQ6735	100ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.