JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

CD229 Antibody / Ly9 (RQ4650)

SKU : BHA17109431

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ4650
Clonality	Polyclonal
Description	T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK were used as the immunogen for the CD229 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No
Subcellular Location	Plasma membrane, cytoplasm

Uniprot	Q9HBG7

Format	Purified
Purification	Antigen affinity purified
Storage	After reconstitution, the CD229 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IHC-P, FACS
Dilution	Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17109431	RQ4650	100ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.