JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

CD18 Antibody (R30292)

SKU : BHA17104017

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R30292
Clonality	Polyclonal
Description	The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the inside-out signaling pathways.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	An amino acid sequence from the N-terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) was used as the immunogen for this CD18 antibody.
Isotype	IgG
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No

Uniprot	P05107

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the CD18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P
Dilution	Weste blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17104017	R30292	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.