JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

14-3-3 zeta Antibody / YWHAZ (RQ4280)

SKU : BHA17109128

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ4280
Clonality	Polyclonal
Description	14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ were used as the immunogen for the 14-3-3 zeta antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No
Subcellular Location	Cytoplasm

Uniprot	P63104

Buffer	Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Format	Antigen affinity purified
Purification	Antigen affinity purified
Storage	After reconstitution, the 14-3-3 zeta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P, IF, ICC, FACS
Dilution	Western blot: 0.5-1ug/ml,Immunofluorescence/Immunocytochemistry (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells,Immunohistochemistry (FFPE): 1-2ug/ml

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17109128	RQ4280	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.