Mouse Anti-Mouse SUR2A Monoclonal IgG2A

Mfr.No.	SMC-431, SMC-431D, SMC-431D-A390, SMC-431D-A488, SMC-431D-A594, SMC-431D-ALP, SMC-431D-APC, SMC-431D-BI, SMC-431D-FITC, SMC-431D-HRP, SMC-431D-PCP, SMC-431D-RPE, SMC-431S
Immunogen Species	Mouse
Alternative Names	ABCC9 Antibody, Sulfonylurea receptor 2 Antibody, CMD10 Antibody, ABC37 Antibody, ATP-binding cassette transporter sub-family C member 9 Antibody, Sulfonylurea receptor 2A Antibody, isoform SUR2A Antibody
Categories	Antibodies
Cellular Localization	Membrane
Certificate Of Analysis	1 ug/ml of SMC-431 was sufficient for detection of SUR2A in 20 ug of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Clonality	Monoclonal
Description	Mouse Anti-Mouse SUR2A Monoclonal IgG2A
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Host	Mouse
Gross Weight (kg)	1.4
Immunogen	Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A, Mus Musculus (Mouse)
Immunogen Region	Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Isotype	IgG2A
Launch Date	2013/03/01
Net Weight (g)	0.1
Reactivity	Rat, Mouse, Human
Recombinant	FALSE
Regulatory	RUO
Species	Mus Musculus (Mouse)
Species Reactivity Medium	Mouse, Rat, Human

Swissprot	P70170
Accession Number	NP_001038185.1
Gene Id	20928
Target	SUR2A
Clone No	S319A-14
Research Area	Cell Markers, Neuron Markers, Membrane Markers, Cell Signaling, Cancer, Neuroscience

Buffer	PBS pH7.4, 50% glycerol, 0.09% sodium azide
Concentration	1 mg/ml
Dilutions	WB (1:1000); optimal dilutions for assays should be determined by the user.
Purification	Protein G Purified
Scientific Background	Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
Shipping Temperature	Blue Ice or 4°C
Specificity	Detects ~120kDa. Does not cross-react with SUR2B.
Storage	-20ºC
Storage Buffer	PBS pH7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated
Storage Temperature	-20°C

Applications	IHC, WB, ICC/IF
Description	WB ; IHC ; ICC ; IF
Dilution	WB (1:1000); optimal dilutions for assays should be determined by the user.

Product Manual	SDS
SDS

Reference	1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042. 2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.

No Description Available.

Have you used this product?

Rate it now..!!

Combination SKU	Supplier No.	Conjugate	Size	Your price
BHA11904096-1	SMC-431D	Unconjugated	100 ug	$330	Add to Cart
BHA11904096-2	SMC-431D-A390	ATTO 390	100 ug	$384	Add to Cart
BHA11904096-3	SMC-431D-A488	ATTO 488	100 ug	$383	Add to Cart
BHA11904096-4	SMC-431D-A594	ATTO 594	100 ug	$383	Add to Cart
BHA11904096-5	SMC-431D-ALP	Alkaline Phosphatase	100 ug	$376	Add to Cart
BHA11904096-6	SMC-431D-APC	APC	100 ug	$382	Add to Cart
BHA11904096-7	SMC-431D-BI	Biotin	100 ug	$378	Add to Cart
BHA11904096-8	SMC-431D-FITC	FITC	100 ug	$374	Add to Cart
BHA11904096-9	SMC-431D-HRP	HRP	100 ug	$370	Add to Cart
BHA11904096-10	SMC-431D-PCP	PerCP	100 ug	$382	Add to Cart
BHA11904096-11	SMC-431D-RPE	RPE	100 ug	$380	Add to Cart
BHA11904096-12	SMC-431S	Unconjugated	12 ug	$44	Add to Cart

SUR2A Antibody, Clone S319A-14 - SMC-431