Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Antibody BHA10203235

Mfr.No.	4214-MSM1-P0
Alternative Names	MEKK1 ; MEK Kinase 1 ; MEKK ; SRXY6 ; MAPKKK1
Categories	Primary Antibodies
Cellular Localization	Cytoplasmic
Chromosome Location	5q11.2
Clonality	Monoclonal
Description	Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFĪŗB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Host	Mouse
Immunogen	Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Isotype	IgG2a Kappa
Positive Control	A431, HeLa or HL-60 cells or liver tissue.
Reactivity	Human
Recombinant	FALSE
Regulatory	RUO

Swissprot	Q13233
Uniprot	653654
Gene Id	4214

Buffer	200μg/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Concentration	200µg/ml
Description	There are no warranties, expressed or implied, which extend beyond this description. Company is not liable for any personal injury or economic loss resulting from this product.
Purity	Purified Ab with BSA and Azide at 200μg/ml

Applications

FACS, IF, WB, IHC-F

Description

(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 10-20 min followed by cooling at RT for 20 minutes); Optimal dilution for a specific application should be determined., FACS ; IF ; WB ; IHC-F

Dilution

FACS	0.5-1μg/million cells in 0.1ml
IF	1-2μg/ml
WB	0.5-1μg/ml
IHC-F	0.5-1μg/ml for 30 minutes at RT

Download

No Description Available.

No Description Available.

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

SKU	Supplier No.	Size	Your price	Quantity
BHA10203235	4214-MSM1-P0	20µg	$204.67		Add to Cart
BHA10203235	4214-MSM1-P0	100µg	$393.20		Add to Cart

Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Antibody BHA10203235

Contact us to order

Tel

Email

Contact us to order

Tel

Email

Reviews of Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Antibody BHA10203235

Rate it now..!!