JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Antibodies

UBC9 Antibody / UBE2I (RQ4620)

SKU : BHA17109411

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ4620
Clonality	Polyclonal
Description	SUMO-conjugating enzyme UBC9 (UBE2I), also called UBC9, is a protein that in humans is encoded by the UBE2I gene. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. It is mapped to 16p13.3. UBC9 could fully complement the mutant phenotype of a yeast ubc9 mutant strain. This gene may play a similar role via interaction with WT1, which is able to impose a block to cell cycle progression in eukaryotic cells. Whatï¿½s more, it could support the growth of yeast ubc9 temperature-sensitive mutants at nonpermissive temperatures, indicating that the gene is a functional homolog of yeast ubc9. UBC9 is specifically associated with FHIT, such as FHIT may be involved in cell cycle control through its interaction with UBC9.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS were used as the immunogen for the UBC9 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No
Subcellular Location	Nuclear, cytoplasmic

Uniprot	P63279

Format	Purified
Purification	Antigen affinity purified
Storage	After reconstitution, the UBC9 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, IHC-P
Dilution	Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17109411	RQ4620	100ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.