JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies

METTL3 Antibody / M6A (RQ6198)

SKU : BHA17110835

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ6198
Clonality	Polyclonal
Description	N6-adenosine-methyltransferase 70 kDa subunit (METTL3) is an enzyme that in humans is encoded by the METTL3 gene. It is mapped to 14q11.2. This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids HNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL from the human protein were used as the immunogen for the METTL3 antibody.
Isotype	IgG
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No
Subcellular Location	Cytoplasmic, nuclear

Uniprot	Q86U44

Format	Antigen affinity purified
Purification	Affinity purified
Storage	After reconstitution, the METTL3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, FACS, IHC-P, IF, Direct ELISA
Dilution	Western blot: 1-2ug/ml,Flow cytometry: 1-3ug/million cells,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Direct ELISA: 0.1-0.5ug/ml

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17110835	RQ6198	100 ug	$419		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.