Mouse Anti-Mouse AtaXin 1 Monoclonal IgG2b

Mfr.No.	SMC-455, SMC-455D, SMC-455D-A390, SMC-455D-A488, SMC-455D-A594, SMC-455D-ALP, SMC-455D-APC, SMC-455D-BI, SMC-455D-FITC, SMC-455D-HRP, SMC-455D-PCP, SMC-455D-RPE, SMC-455S
Immunogen Species	Mouse
Alternative Names	Ataxin-1 Antibody, ATX1 Antibody, Atxn1 Antibody, D6S504E Antibody, OTTHUMP00000016065 Antibody, SCA1 Antibody, Spinocerebellar ataxia type 1 protein Antibody
Categories	Antibodies
Cellular Localization	Cytoplasm, Nucleus
Certificate Of Analysis	1 ug/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 ug of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Clonality	Monoclonal
Description	Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Host	Mouse
Gross Weight (kg)	1.4
Immunogen	Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical)., Mus Musculus (Mouse)
Immunogen Region	Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Isotype	IgG2b
Launch Date	2013/10/29
Net Weight (g)	0.1
Reactivity	Rat, Mouse, Human
Recombinant	FALSE
Regulatory	RUO
Species	Mus Musculus (Mouse)
Species Reactivity Medium	Mouse, Rat, Human

Swissprot	P54254
Accession Number	NP_001186233.1
Gene Id	20238
Target	Ataxin 1
Clone No	S76-8
Research Area	Neurodegeneration, Cell Signaling, Epigenetics and Nuclear Signaling, Neuroscience

Buffer	PBS pH 7.4, 50% glycerol, 0.1% sodium azide
Concentration	1 mg/ml
Dilutions	WB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Purification	Protein G Purified
Scientific Background	Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
Shipping Temperature	Blue Ice or 4°C
Specificity	Detects ~85kDa.
Storage	-20ºC
Storage Buffer	PBS pH 7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated
Storage Temperature	-20°C

Applications	IHC, IP, WB, ICC/IF
Description	WB ; IHC ; ICC ; IF ; IP
Dilution	WB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.

Product Manual	SDS
SDS

No Description Available.

Have you used this product?

Rate it now..!!

Combination SKU	Supplier No.	Conjugate	Size	Your price
BHA11904552-1	SMC-455D	Unconjugated	100 ug	$330	Add to Cart
BHA11904552-2	SMC-455D-A390	ATTO 390	100 ug	$384	Add to Cart
BHA11904552-3	SMC-455D-A488	ATTO 488	100 ug	$383	Add to Cart
BHA11904552-4	SMC-455D-A594	ATTO 594	100 ug	$383	Add to Cart
BHA11904552-5	SMC-455D-ALP	Alkaline Phosphatase	100 ug	$376	Add to Cart
BHA11904552-6	SMC-455D-APC	APC	100 ug	$382	Add to Cart
BHA11904552-7	SMC-455D-BI	Biotin	100 ug	$378	Add to Cart
BHA11904552-8	SMC-455D-FITC	FITC	100 ug	$374	Add to Cart
BHA11904552-9	SMC-455D-HRP	HRP	100 ug	$370	Add to Cart
BHA11904552-10	SMC-455D-PCP	PerCP	100 ug	$382	Add to Cart
BHA11904552-11	SMC-455D-RPE	RPE	100 ug	$380	Add to Cart
BHA11904552-12	SMC-455S	Unconjugated	12 ug	$44	Add to Cart

Ataxin 1 Antibody, Clone S76-8 - SMC-455