JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.
Loding Loading ....
Home / Antibodies

Anti-TGFB2 Antibody BHA11000717

BHA11000717
Contact us to order
Tel
+1 866.986.9598
Email
[email protected]
Get a Quote
Request More Infos
Order Now

Credit card payments now incur a 3% fee.

Contact us to order
Tel
+1 866.986.9598
Email
[email protected]
Get a Quote
Ask Merchant
Request More Infos
Sample Request
Sequence ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Description Transportation method: Shipped with Ice Packs
Formulation: Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility: Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.
Purification Method: Purified IgG prepared by affinity chromatography on protein G.
Stability / Shelf Life: Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended.
Purity Greater than 98%.
Applications WB
Description WB
SKU Supplier No. Size Your price Quantity
BHA11000717 ANT-035 5µg $81.50
Add to Cart
BHA11000717 ANT-035 20µg $153.89
Add to Cart
BHA11000717 ANT-035 100µg $475
Add to Cart