JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
[email protected]

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Monoclonal Antibodies

Anti-CD19-Anti-CD3 Bispecific Antibody (100 ug)

SKU : BHA18200043

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Request More Infos

BPS Bioscience

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

[email protected]

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	100441-2
Background	Blinatumomab is a biopharmaceutical drug used as a second-line treatment for Philadelphia chromosome-negative relapsed or refractory acute lymphoblastic leukemia. It binds to CD19 on cancer cells (e.g. Raji cells) and CD3 on T cells simultaneously, thus bringing T lymphocytes closer to the cancer cells. The binding event potentiates unstimulated T cells and induces direct cytotoxicity against CD19+ cancer cells
Clonality	Monoclonal (Bispecific)
Description	Anti-CD19-Anti-CD3-His-Tag is a purified recombinant human bispecific T cell Engager (BiTE) based on Amgen's Blinatumomab. This BiTE has been tested for specific activity in both ELISA binding assay to CD19-biotin and functional reporter assays using Jurkat/NFAT-luc or Jurkat/IL2-Luc reporter cell lines in the presence of CD19+ Raji cells.
Formulation	8 mM phosphate, 110 mM NaCl, 2.2 mM KCl, pH 7.4, and 20% glycerol
Molecular Weight	56 kDa
Species	Human
Synonyms	Bite, cd19 bite, blinatumomba, bispecific antibody, cd3 bite
Note	This product is for research use only. It is not suitable for human diagnostic or therapeutic use. Avoid freeze/thaw cycles.

Sequence	MALPVTALLLPLALLLHAARP DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKLLIYDASNLVS GIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPWTFGGGTKLEIKGGGGSGGGG SGGGGSQVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIWPG DGDTNYNGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYW GQGTTVTVSSGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGL EWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYC LDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSASPGEKVTMTCRASSS VSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQ QWSSNPLTFGAGTKLELKHHHHHH

Format	Aqueous Buffer Solution
Purification	Ni-NTA affinity purification of the His-tag protein from HEK293 cells.
Shipping Temperature	-80°C (dry ice)
Storage Stability	Stable for at least 12 months at -80°C. Avoid freeze/thaw cycles.

Product Manual	Datasheet

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA18200043	100441-2	100 ug	$588.50		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2024 Biohippo. All rights reserved.