HO-1 Protein - BHP11900121

Mfr.No.	SPR-315, SPR-315A, SPR-315B, SPR-315C
Alternative Names	Heme oxygenase 1 Protein, Hemox Protein, HMOX1 Protein, HO1 Protein, HO 1 Protein, HSP32 Protein
Antigen	HO-1
Cellular Localization	Endoplasmic Reticulum, Microsome
Certificate Of Analysis	This product has been certified >90% pure using SDSPAGE analysis.
Conjugate	His tag
Description	Rat Recombinant HO-1 Partial Protein
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Regulatory	RUO
Scientific Background	Heme-oxygenase is a ubiquitous enzyme that catalyzes the initial and rate-limiting steps in heme catabolism yielding equimolar amounts of biliverdin, iron and carbon monoxide. Biliverdin is subsequently converted to bilirubin and the free iron is sequestered to ferritin (1). These products have important physiological effects as carbon monoxide is a potent vasodilator; biliverdin and bilirubin are potent antioxidants; and the free iron increases oxidative stress and regulates the expression of many mRNAs (2).There are three isoforms of heme-oxygenase, HO-1, HO-2 and HO-3; however HO-1 and HO-2 are the major isoforms as they both have been identified in mammals (3). HO-1, also known as heat shock protein 32, is an inducible isoform activated by most oxidative stress inducers, cytokines, inflammatory agents and heat shock. HO-2 is a constitutive isoform which is expressed under homeostatic conditions. HO-1 is also considered to be a cytoprotective factor in that free heme is highly reactive and cytotoxic, and secondly, carbon monoxide is a mediator inhibiting the inflammatory process and bilirubin is a scavenger for reactive oxygen, both of which are the end products of heme catalyzation (4). It has also been shown that HO-1 deficiency may cause reduced stress defense, a pro-inflammatory tendency (5), susceptibility to atherosclerotic lesion formation (6), endothelial cell injury, and growth retardation (7). Up-regulation of HO-1 is therefore said to be one of the major defense mechanisms of oxidative stress (4).
Species	Rat
Specificity	~32 kDa
Accession Number	NP_036712.1
Concentration	Lot/batch specific. See included datasheet.
Purification	Affinity Purified
Expression System	E. coli
Amino Acid Sequence	MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQIST
Cite This Product	Rat Recombinant HO-1 Protein (StressMarq Biosciences, Canada, Cat # SPR-315A)
Mol Weight	~32 kDa
Nature	Recombinant
Protein Length	Partial

Gross Weight (kg)	1.4
Launch Date	2012/06/01
Net Weight (g)	0.05
Swissprot	P06762
Target Details	HO-1
Gene Id	24451
Research Area	Cancer, Oxidative Stress
Target	HO-1

Adr Code	Non-hazardous
Country Of Origin	Canada
Field Of Use	Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Shipping	Blue Ice or 4ºC
Stock Product	Y
Tarriff Code	3822.19.0030
Un Code For Transport	Non-hazardous
Unspsc Code	12352202
Shipping Temperature	Blue Ice or 4°C
Buffer	50mM Tris/HCl pH7.5, 5mM Bme, 0.15NaCl, 10% glycerol
Description	Accession Number: NP_036712.1 Specificity: ~32 kDa Certificate of Analysis: This product has been certified >90% pure using SDSPAGE analysis. Country of Origin: Canada Gross Weight (kg): 1.4 Net Weight (g): 0.05 Stock Product: Y
Purity	>90%
Storage Buffer	50mM Tris/HCl pH7.5, 5mM Bme, 0.15NaCl, 10% glycerol
Storage Temperature	-20°C

Immunogen Species	Rattus Norvegicus (Rat)
Applications	WB, SDS-PAGE

Reference	1. Froh M. et al. (2007) World J. Gastroentereol 13(25): 3478-86. 2. Elbirt K.K. and Bonkovsky H.L. (1999) Proc Assoc Am Physicians 111(5): 348-47. 3. Maines M.D., Trakshel G.M., and Kutty R.K. (1986) J Biol Chem 261: 411419. 4. Brydun A., et al. (2007) Hypertens Res 30(4): 341-8. 5. Poss K.D. and Tonegawa S. (1997). Proc Natl Acad Sci U S A. 94: 1092510930. 6. Yet S.F., et al. (2003) FASEB J. 17: 17591761. 7. Yachie A., et al. (1999) J Clin Invest. 103: 129135.

Product Manual	Datasheet
SDS

Have you used this product?

Rate it now..!!

Combination SKU	Supplier No.	Size	Your price
BHP11900121-1	SPR-315A	50 ug	$226	Add to Cart
BHP11900121-2	SPR-315B	100 ug	$405	Add to Cart
BHP11900121-3	SPR-315C	100 ug x2	$572	Add to Cart

Rat Recombinant HO-1 Partial Protein

Contact us to order

Tel

Email

Contact us to order

Tel

Email

Reviews of Rat Recombinant HO-1 Partial Protein

Rate it now..!!